Recombinant Bovine Myoglobin (MB)

Produktübersicht

• Artikelname: Recombinant Bovine Myoglobin (MB)
• Artikelnummer: CSB-YP013529BO
• Hersteller Artikelnummer: CSB-YP013529BO
• Alternativnummer: CSB-YP013529BO-1, CSB-YP013529BO-100, CSB-YP013529BO-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: ,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 17.6 kDa
• Tag: Tag-Free
• UniProt: P02192
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 2-154aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: GLSDGEWQLVLNAWGKVEADVAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASEDLKKHGNTVLTALGGILKKKGHHEAEVKHLAESHANKHKIPVKYLEFISDAIIHVLHAKHPSDFGADAQAAMSKALELFRNDMAAQYKVLGFHG