Recombinant Human Mannose-binding protein C (MBL2)

Artikelnummer: CSB-YP013540HU
Artikelname: Recombinant Human Mannose-binding protein C (MBL2)
Artikelnummer: CSB-YP013540HU
Hersteller Artikelnummer: CSB-YP013540HU
Alternativnummer: CSB-YP013540HU-1, CSB-YP013540HU-100, CSB-YP013540HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Collectin-1MBP1Mannan-binding protein,Mannose-binding lectin
Molekulargewicht: 26 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P11226
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Expression System: 21-248aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI