Recombinant Human Protein-methionine sulfoxide oxidase MICAL2 (MICAL2), partial
Artikelnummer:
CSB-YP013808HU
- Bilder (0)
| Artikelname: | Recombinant Human Protein-methionine sulfoxide oxidase MICAL2 (MICAL2), partial |
| Artikelnummer: | CSB-YP013808HU |
| Hersteller Artikelnummer: | CSB-YP013808HU |
| Alternativnummer: | CSB-YP013808HU-1, CSB-YP013808HU-100, CSB-YP013808HU-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Molecule interacting with CasL protein 2 ,MICAL-2 |
| Molekulargewicht: | 58.5 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | O94851 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Yeast |
| Expression System: | 1-495aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MGENEDEKQAQAGQVFENFVQASTCKGTLQAFNILTRHLDLDPLDHRNFYSKLKSKVTTWKAKALWYKLDKRGSHKEYKRGKSCTNTKCLIVGGGPCGLRTAIELAYLGAKVVVVEKRDSFSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGSIDHISIRQLQLILFKVALMLGVEIHVNVEFVKVLEPPEDQENQKIGWRAEFLPTDHSLSEFEFDVIIGADGRRNTLEGFRRKEFRGKLAIAITANFINRNS |
Produktgarantie und fachkundiger Support
