Recombinant Human Macrophage migration inhibitory factor (MIF)

Produktübersicht

• Artikelname: Recombinant Human Macrophage migration inhibitory factor (MIF)
• Artikelnummer: CSB-YP013826HU
• Hersteller Artikelnummer: CSB-YP013826HU
• Alternativnummer: CSB-YP013826HU-1, CSB-YP013826HU-100, CSB-YP013826HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Glycosylation-inhibiting factor Short name: GIF L-dopachrome isomerase L-dopachrome tautomerase (EC:5.3.3.12) Phenylpyruvate tautomerase MIF GLIF, MMIF

Produkteigenschaften

• Molekulargewicht: 14.4 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: P14174
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 2-115aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA