Recombinant Rat Matrilysin (Mmp7)

Produktübersicht

• Artikelname: Recombinant Rat Matrilysin (Mmp7)
• Artikelnummer: CSB-YP014677RA
• Hersteller Artikelnummer: CSB-YP014677RA
• Alternativnummer: CSB-YP014677RA-1, CSB-YP014677RA-100, CSB-YP014677RA-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Matrin,Matrix metalloproteinase-7 ,MMP-7Pump-1 proteaseUterine metalloproteinase

Produkteigenschaften

• Molekulargewicht: 20.9 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: P50280
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 98-267aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: FSLMPNSPKWHSRTVTYRIVSYTTDLPRFLVDQIVKRALRMWSMQIPLNFKRVSWGTADIIIGFARGDHGDNFPFDGPGNTLGHAFAPGPGLGGDAHFDKDEYWTDGEDSGVNFLFVATHELGHSLGLGHSSVPSSVMYPTYQGDHSEDFSLTKDDIAGIQKLYGKRNKL