Recombinant Human Macrophage mannose receptor 1 (MRC1), partial

Artikelnummer: CSB-YP014783HU
Artikelname: Recombinant Human Macrophage mannose receptor 1 (MRC1), partial
Artikelnummer: CSB-YP014783HU
Hersteller Artikelnummer: CSB-YP014783HU
Alternativnummer: CSB-YP014783HU-1, CSB-YP014783HU-100, CSB-YP014783HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: C-type lectin domain family 13 member DC-type lectin domain family 13 member D-like,Macrophage mannose receptor 1-like protein 1, CD206
Molekulargewicht: 66.4 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P22897
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Expression System: 655-1213aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: RTSLCFKLYAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHKLFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPNFANEDENCVTMYSNSGF