Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1), partial

Artikelnummer: CSB-YP015007MO1
Artikelname: Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1), partial
Artikelnummer: CSB-YP015007MO1
Hersteller Artikelnummer: CSB-YP015007MO1
Alternativnummer: CSB-YP015007MO1-1, CSB-YP015007MO1-100, CSB-YP015007MO1-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: B-cell differentiation antigen Ly-44Lymphocyte antigen 44Membrane-spanning 4-domains subfamily A member 1, CD20
Molekulargewicht: 22.3 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P19437
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Expression System: 111-291aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: VIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP