Recombinant Bovine Myotrophin (MTPN)
Artikelnummer:
CSB-YP015195BOB0
- Bilder (0)
| Artikelname: | Recombinant Bovine Myotrophin (MTPN) |
| Artikelnummer: | CSB-YP015195BOB0 |
| Hersteller Artikelnummer: | CSB-YP015195BOb0 |
| Alternativnummer: | CSB-YP015195BOB0-1, CSB-YP015195BOB0-100, CSB-YP015195BOB0-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | MTPN, Myotrophin,CSB-PR2024 |
| Molekulargewicht: | 15.2 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | Q3T0F7 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Yeast |
| Expression System: | 2-118aa |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | CDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ |
Produktgarantie und fachkundiger Support
