Recombinant Mouse Sialidase-1 (Neu1)

Produktübersicht

• Artikelname: Recombinant Mouse Sialidase-1 (Neu1)
• Artikelnummer: CSB-YP015717MO
• Hersteller Artikelnummer: CSB-YP015717MO
• Alternativnummer: CSB-YP015717MO-1, CSB-YP015717MO-100, CSB-YP015717MO-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: G9 sialidase (Lysosomal sialidase) (N-acetyl-alpha-neuraminidase 1) (Neu)

Produkteigenschaften

• Molekulargewicht: 42.3 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: O35657
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 42-409aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: EDDFSLVQPLVTMEQLLWVSGKQIGSVDTFRIPLITATPRGTLLAFAEARKKSASDEGAKFIAMRRSTDQGSTWSSTAFIVDDGEASDGLNLGAVVNDVDTGIVFLIYTLCAHKVNCQVASTMLVWSKDDGISWSPPRNLSVDIGTEMFAPGPGSGIQKQREPGKGRLIVCGHGTLERDGVFCLLSDDHGASWHYGTGVSGIPFGQPKHDHDFNPDECQPYELPDGSVIINARNQNNYHCRCRIVLRSYDACDT