Recombinant Human Protein BEX3 (NGFRAP1)

Produktübersicht

• Artikelname: Recombinant Human Protein BEX3 (NGFRAP1)
• Artikelnummer: CSB-YP015781HU
• Hersteller Artikelnummer: CSB-YP015781HU
• Alternativnummer: CSB-YP015781HU-1, CSB-YP015781HU-100, CSB-YP015781HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Brain-expressed X-linked protein 3Nerve growth factor receptor-associated protein 1Ovarian granulosa cell 13.0KDA protein HGR74p75NTR-associated cell death executor

Produkteigenschaften

• Molekulargewicht: 15 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: Q00994
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 1-111aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP