Recombinant Human Atrial natriuretic peptide receptor 3 (NPR3), partial
Artikelnummer:
CSB-YP016025HU1F3
- Bilder (0)
| Artikelname: | Recombinant Human Atrial natriuretic peptide receptor 3 (NPR3), partial |
| Artikelnummer: | CSB-YP016025HU1F3 |
| Hersteller Artikelnummer: | CSB-YP016025HU1f3 |
| Alternativnummer: | CSB-YP016025HU1F3-1, CSB-YP016025HU1F3-100, CSB-YP016025HU1F3-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Atrial natriuretic peptide clearance receptor (Atrial natriuretic peptide receptor type C) (ANP-C) (ANPR-C) (NPR-C) (ANPRC) (C5orf23) (NPRC) |
| Molekulargewicht: | 53.4 kDa |
| Tag: | C-terminal 6xHis-Myc-tagged |
| UniProt: | P17342 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Yeast |
| Expression System: | 27-481aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | GGVGGGGGGAGIGGGRQEREALPPQKIEVLVLLPQDDSYLFSLTRVRPAIEYALRSVEGNGTGRRLLPPGTRFQVAYEDSDCGNRALFSLVDRVAAARGAKPDLILGPVCEYAAAPVARLASHWDLPMLSAGALAAGFQHKDSEYSHLTRVAPAYAKMGEMMLALFRHHHWSRAALVYSDDKLERNCYFTLEGVHEVFQEEGLHTSIYSFDETKDLDLEDIVRNIQASERVVIMCASSDTIRSIMLVAHRHGMT |
Produktgarantie und fachkundiger Support
