Recombinant Mouse Pro-neuropeptide Y (Npy), partial
Artikelnummer:
CSB-YP016034MO
- Bilder (0)
| Artikelname: | Recombinant Mouse Pro-neuropeptide Y (Npy), partial |
| Artikelnummer: | CSB-YP016034MO |
| Hersteller Artikelnummer: | CSB-YP016034MO |
| Alternativnummer: | CSB-YP016034MO-1, CSB-YP016034MO-100, CSB-YP016034MO-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Pro-neuropeptide Y [Cleaved into: Neuropeptide Y(Neuropeptide tyrosine)(NPY), C-flanking peptide of NPY(CPON)] |
| Molekulargewicht: | 30.9 kDa |
| Tag: | N-terminal hFc-tagged |
| UniProt: | P57774 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Yeast |
| Expression System: | 29-64aa |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY |
Produktgarantie und fachkundiger Support
