Recombinant Human 7,8-dihydro-8-oxoguanine triphosphatase (NUDT1)

Produktübersicht

• Artikelname: Recombinant Human 7,8-dihydro-8-oxoguanine triphosphatase (NUDT1)
• Artikelnummer: CSB-YP016154HUA0
• Hersteller Artikelnummer: CSB-YP016154HUa0
• Alternativnummer: CSB-YP016154HUA0-1, CSB-YP016154HUA0-100, CSB-YP016154HUA0-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: 2-hydroxy-dATP diphosphatase (EC:3.6.1.56) 8-oxo-dGTPase Nucleoside diphosphate-linked moiety X motif 1 MTH1

Produkteigenschaften

• Molekulargewicht: 22.3 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: P36639
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 19-197aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV