Recombinant Human Oligodendrocyte transcription factor 1 (OLIG1), partial

Artikelnummer: CSB-YP016328HU
Artikelname: Recombinant Human Oligodendrocyte transcription factor 1 (OLIG1), partial
Artikelnummer: CSB-YP016328HU
Hersteller Artikelnummer: CSB-YP016328HU
Alternativnummer: CSB-YP016328HU-1, CSB-YP016328HU-100, CSB-YP016328HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Class B basic helix-loop-helix protein 6 Short name: bHLHb6 Class E basic helix-loop-helix protein 21 Short name: bHLHe21
Molekulargewicht: 11.1 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q8TAK6
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Expression System: 17-105aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTSSTSSTSSSSTTAPLLPKAAREKPEAPAEPPGPGPGSGAHPGGSARPDAKEEQQQQ