Recombinant Mouse Otoraplin (Otor)
Artikelnummer:
CSB-YP017277MO
- Bilder (0)
| Artikelname: | Recombinant Mouse Otoraplin (Otor) |
| Artikelnummer: | CSB-YP017277MO |
| Hersteller Artikelnummer: | CSB-YP017277MO |
| Alternativnummer: | CSB-YP017277MO-1, CSB-YP017277MO-100, CSB-YP017277MO-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | (Melanoma inhibitory activity-like protein),CSB-PR2024 |
| Molekulargewicht: | 14.0 kDa |
| Tag: | C-terminal 6xHis-tagged |
| UniProt: | Q9JIE3 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Yeast |
| Expression System: | 19-128aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | HGVFMDKLSSKKLCADEECVYTISLARAQEDYNAPDCRFIDVKKGQQIYVYSKLVTENGAGEFWAGSVYGDHQDEMGIVGYFPSNLVKEQRVYQEATKEIPTTDIDFFCE |
Produktgarantie und fachkundiger Support
