Recombinant Escherichia coli O157:H7 Peptide deformylase (def)

Produktübersicht

• Artikelname: Recombinant Escherichia coli O157:H7 Peptide deformylase (def)
• Artikelnummer: CSB-YP017707EOD
• Hersteller Artikelnummer: CSB-YP017707EOD
• Alternativnummer: CSB-YP017707EOD-1, CSB-YP017707EOD-100, CSB-YP017707EOD-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Polypeptide deformylase,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 21.2 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: P0A6K5
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 2-169aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRLKARA