Recombinant Human Prolactin-inducible protein (PIP)

Produktübersicht

• Artikelname: Recombinant Human Prolactin-inducible protein (PIP)
• Artikelnummer: CSB-YP018020HU
• Hersteller Artikelnummer: CSB-YP018020HU
• Alternativnummer: CSB-YP018020HU-1, CSB-YP018020HU-100, CSB-YP018020HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Gross cystic disease fluid protein 15

Produkteigenschaften

• Molekulargewicht: 16 kDa
• Tag: N-terminal 10xHis-tagged
• UniProt: P12273
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 29-146aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE