Recombinant Human Cardiac phospholamban (PLN)

Produktübersicht

• Artikelname: Recombinant Human Cardiac phospholamban (PLN)
• Artikelnummer: CSB-YP018198HU
• Hersteller Artikelnummer: CSB-YP018198HU
• Alternativnummer: CSB-YP018198HU-1, CSB-YP018198HU-100, CSB-YP018198HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Cardiac phospholamban, CMD1P, CMH18, PLB, Pln, PPLA_HUMAN

Produkteigenschaften

• Molekulargewicht: 33.1 kDa
• Tag: N-terminal GST-tagged
• UniProt: P26678
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 1-52aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL