Recombinant Human Peroxiredoxin-1 (PRDX1)
Artikelnummer:
CSB-YP018653HU
- Bilder (0)
| Artikelname: | Recombinant Human Peroxiredoxin-1 (PRDX1) |
| Artikelnummer: | CSB-YP018653HU |
| Hersteller Artikelnummer: | CSB-YP018653HU |
| Alternativnummer: | CSB-YP018653HU-1, CSB-YP018653HU-100, CSB-YP018653HU-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Natural killer cell-enhancing factor A Proliferation-associated gene protein Thioredoxin peroxidase 2 Thioredoxin-dependent peroxide reductase 2 PAGA, PAGB, TDPX2,CSB-PR2024 |
| Molekulargewicht: | 24.6 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | Q06830 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Yeast |
| Expression System: | 1-199aa |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK |
Produktgarantie und fachkundiger Support
