Recombinant Pig Prolactin (PRL)

Artikelnummer: CSB-YP018724PI
Artikelname: Recombinant Pig Prolactin (PRL)
Artikelnummer: CSB-YP018724PI
Hersteller Artikelnummer: CSB-YP018724PI
Alternativnummer: CSB-YP018724PI-1, CSB-YP018724PI-100, CSB-YP018724PI-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: PRL, Prolactin, PRL
Molekulargewicht: 25 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P01238
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Expression System: 31-229aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEVLLNLILRVLRSWNDPLYHLVTEVRGMQEAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPGIKENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC