Recombinant Bovine Enteropeptidase (TMPRSS15), partial

Produktübersicht

• Artikelname: Recombinant Bovine Enteropeptidase (TMPRSS15), partial
• Artikelnummer: CSB-YP018824BO
• Hersteller Artikelnummer: CSB-YP018824BO
• Alternativnummer: CSB-YP018824BO-1, CSB-YP018824BO-100, CSB-YP018824BO-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Enterokinase Serine protease 7 Transmembrane protease serine 15 ENTK, PRSS7,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 28.3 kDa
• Tag: C-terminal 6xHis-tagged
• UniProt: P98072
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 801-1035aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: IVGGSDSREGAWPWVVALYFDDQQVCGASLVSRDWLVSAAHCVYGRNMEPSKWKAVLGLHMASNLTSPQIETRLIDQIVINPHYNKRRKNNDIAMMHLEMKVNYTDYIQPICLPEENQVFPPGRICSIAGWGALIYQGSTADVLQEADVPLLSNEKCQQQMPEYNITENMVCAGYEAGGVDSCQGDSGGPLMCQENNRWLLAGVTSFGYQCALPNRPGVYARVPRFTEWIQSFLH