Recombinant Guinea pig Saposin-C (PSAP)
Artikelnummer:
CSB-YP018836GU
- Bilder (0)
| Artikelname: | Recombinant Guinea pig Saposin-C (PSAP) |
| Artikelnummer: | CSB-YP018836GU |
| Hersteller Artikelnummer: | CSB-YP018836GU |
| Alternativnummer: | CSB-YP018836GU-1, CSB-YP018836GU-100, CSB-YP018836GU-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Co-beta-glucosidaseGlucosylceramidase activatorSphingolipid activator protein 2 ,SAP-2,CSB-PR2024 |
| Molekulargewicht: | 10.9 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P20097 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Yeast |
| Expression System: | 1-81aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | ESVTCKACEYVVKKVMELIDNNRTEEKIIHALDSVCALLPESVSEVCQEVVDTYGDSIVALLLQEMSPELVCSELGLCMSG |
Produktgarantie und fachkundiger Support
