Recombinant Pig Saposin-B-Val (PSAP)
Artikelnummer:
CSB-YP018836PI
- Bilder (0)
| Artikelname: | Recombinant Pig Saposin-B-Val (PSAP) |
| Artikelnummer: | CSB-YP018836PI |
| Hersteller Artikelnummer: | CSB-YP018836PI |
| Alternativnummer: | CSB-YP018836PI-1, CSB-YP018836PI-100, CSB-YP018836PI-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Cerebroside sulfate activator (CS-ACT) (Non-specific activator) (Sphingolipid activator protein 1) (SAP-1),CSB-PR2024 |
| Molekulargewicht: | 11.9 kDa |
| Tag: | N-terminal 6xHis-Flag-tagged |
| UniProt: | P81405 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Yeast |
| Expression System: | 1-80aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | GDVCQDCIQMVTDLQNAVRTNSTFVEALVNHAKEECDRLGPGMADMCKNYISQYSEIAIQMMMHMQPKDICGLVGFCEEV |
Produktgarantie und fachkundiger Support
