Recombinant Human Receptor-type tyrosine-protein phosphatase beta (PTPRB), partial

Produktübersicht

• Artikelname: Recombinant Human Receptor-type tyrosine-protein phosphatase beta (PTPRB), partial
• Artikelnummer: CSB-YP019048HU
• Hersteller Artikelnummer: CSB-YP019048HU
• Alternativnummer: CSB-YP019048HU-1, CSB-YP019048HU-100, CSB-YP019048HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Vascular endothelial protein tyrosine phosphatase Short name: VE-PTP

Produkteigenschaften

• Molekulargewicht: 43.4 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: P23467
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 1643-1997aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: RQKVSHGRERPSARLSIRRDRPLSVHLNLGQKGNRKTSCPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYDATRVKLSNVDDDPCSDYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQDSLYYGDLILQMLSESVLPEWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPG