Recombinant Human Receptor-type tyrosine-protein phosphatase zeta (PTPRZ1), partial

Artikelnummer: CSB-YP019068HU
Artikelname: Recombinant Human Receptor-type tyrosine-protein phosphatase zeta (PTPRZ1), partial
Artikelnummer: CSB-YP019068HU
Hersteller Artikelnummer: CSB-YP019068HU
Alternativnummer: CSB-YP019068HU-1, CSB-YP019068HU-100, CSB-YP019068HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Protein-tyrosine phosphatase receptor type Z polypeptide 1,Protein-tyrosine phosphatase receptor type Z polypeptide 2R-PTP-zeta-2
Molekulargewicht: 32.1 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P23471
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Expression System: 36-300aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: IGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQ