Recombinant Human Peptide YY (PYY), partial

Produktübersicht

• Artikelname: Recombinant Human Peptide YY (PYY), partial
• Artikelnummer: CSB-YP019128HU1
• Hersteller Artikelnummer: CSB-YP019128HU1
• Alternativnummer: CSB-YP019128HU1-1, CSB-YP019128HU1-100, CSB-YP019128HU1-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: PYY-I (PYY)

Produkteigenschaften

• Molekulargewicht: 6.1 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: P10082
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 31-64aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: IKPEAPREDASPEELNRYYASLRHYLNLVTRQRY