Recombinant Mouse Glutaminyl-peptide cyclotransferase (Qpct)
Artikelnummer:
CSB-YP019135MO
- Bilder (0)
| Artikelname: | Recombinant Mouse Glutaminyl-peptide cyclotransferase (Qpct) |
| Artikelnummer: | CSB-YP019135MO |
| Hersteller Artikelnummer: | CSB-YP019135MO |
| Alternativnummer: | CSB-YP019135MO-1, CSB-YP019135MO-100, CSB-YP019135MO-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Glutaminyl cyclase |
| Molekulargewicht: | 39.6 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q9CYK2 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Yeast |
| Expression System: | 36-362aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | AWTQEKNHHQPAHLNSSSLQQVAEGTSISEMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVDTFLSRTPYGYRSFSNIISTLNPEAKRHLVLACHYDSKYFPRWDSRVFVGATDSAVPCAMMLELARALDKKLHSLKDVSGSKPDLSLRLIFFDGEEAFHHWSPQDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLLVLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELYELGLLKDHS |
Produktgarantie und fachkundiger Support
