Recombinant Human E3 SUMO-protein ligase RanBP2 (RANBP2), partial

Artikelnummer: CSB-YP019311HU
Artikelname: Recombinant Human E3 SUMO-protein ligase RanBP2 (RANBP2), partial
Artikelnummer: CSB-YP019311HU
Hersteller Artikelnummer: CSB-YP019311HU
Alternativnummer: CSB-YP019311HU-1, CSB-YP019311HU-100, CSB-YP019311HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: 358KDA nucleoporin Nuclear pore complex protein Nup358 Nucleoporin Nup358 Ran-binding protein 2
Molekulargewicht: 24.8 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P49792
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Expression System: 2601-2802aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: PTEESSINYTFKTPEKAKEKKKPEDSPSDDDVLIVYELTPTAEQKALATKLKLPPTFFCYKNRPDYVSEEEEDDEDFETAVKKLNGKLYLDGSEKCRPLEENTADNEKECIIVWEKKPTVEEKAKADTLKLPPTFFCGVCSDTDEDNGNGEDFQSELQKVQEAQKSQTEEITSTTDSVYTGGTEVMVPSFCKSEEPDSITKS