Recombinant Human Putative RNA-binding protein 3 (RBM3)

Produktübersicht

• Artikelname: Recombinant Human Putative RNA-binding protein 3 (RBM3)
• Artikelnummer: CSB-YP019420HU
• Hersteller Artikelnummer: CSB-YP019420HU
• Alternativnummer: CSB-YP019420HU-1, CSB-YP019420HU-100, CSB-YP019420HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: RNA-binding motif protein 3RNPL

Produkteigenschaften

• Molekulargewicht: 19.2 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: P98179
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 1-157aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNYRDNYDN