Recombinant Mouse Regenerating islet-derived protein 3-gamma (Reg3g)

Artikelnummer: CSB-YP019549MO
Artikelname: Recombinant Mouse Regenerating islet-derived protein 3-gamma (Reg3g)
Artikelnummer: CSB-YP019549MO
Hersteller Artikelnummer: CSB-YP019549MO
Alternativnummer: CSB-YP019549MO-1, CSB-YP019549MO-100, CSB-YP019549MO-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Pancreatitis-associated protein 3Regenerating islet-derived protein III-gamma ,Reg III-gamma,CSB-PR2024
Molekulargewicht: 18.3 kDa
Tag: N-terminal 6xHis-tagged
UniProt: O09049
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Expression System: 27-174aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: EVAKKDAPSSRSSCPKGSRAYGSYCYALFSVSKNWYDADMACQKRPSGHLVSVLSGAEASFLSSMIKSSGNSGQYVWIGLHDPTLGYEPNRGGWEWSNADVMNYINWETNPSSSSGNHCGTLSRASGFLKWRENYCNLELPYVCKFKA