Recombinant Human Proto-oncogene c-Rel (REL), partial
Artikelnummer:
CSB-YP019552HU
- Bilder (0)
| Artikelname: | Recombinant Human Proto-oncogene c-Rel (REL), partial |
| Artikelnummer: | CSB-YP019552HU |
| Hersteller Artikelnummer: | CSB-YP019552HU |
| Alternativnummer: | CSB-YP019552HU-1, CSB-YP019552HU-100, CSB-YP019552HU-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Avian reticuloendotheliosis , C REL, C Rel protein, c Rel proto oncogene protein, Oncogene REL , Oncogene REL avian reticuloendotheliosis, Proto-oncogene c-Rel, REL, REL_HUMAN, v rel avian reticuloendotheliosis viral oncogene homolog, v rel reticuloendot,CSB-PR2024 |
| Molekulargewicht: | 66.6 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q04864 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Yeast |
| Expression System: | 3-616aa |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | SGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGKVRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRAPNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQVAIVFKTPPYCKAITEP |
Produktgarantie und fachkundiger Support
