Recombinant Rat Regucalcin (Rgn)

Produktübersicht

• Artikelname: Recombinant Rat Regucalcin (Rgn)
• Artikelnummer: CSB-YP019630RA
• Hersteller Artikelnummer: CSB-YP019630RA
• Alternativnummer: CSB-YP019630RA-1, CSB-YP019630RA-100, CSB-YP019630RA-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Gluconolactonase (EC:3.1.1.17) Short name: GNL Senescence marker protein 30 Short name: SMP-30

Produkteigenschaften

• Molekulargewicht: 35.4 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: Q03336
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 1-299aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MSSIKIECVLRENYRCGESPVWEEASKCLLFVDIPSKTVCRWDSISNRVQRVGVDAPVSSVALRQSGGYVATIGTKFCALNWEDQSVFILAMVDEDKKNNRFNDGKVDPAGRYFAGTMAEETAPAVLERHQGSLYSLFPDHSVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYTVDAFDYDLPTGQISNRRTVYKMEKDEQIPDGMCIDVEGKLWVACYNGGRVIRLDPETGKRLQTVKLPVDKTTSCCFGGKD