Recombinant Human RING-box protein 2 (RNF7)

Produktübersicht

• Artikelname: Recombinant Human RING-box protein 2 (RNF7)
• Artikelnummer: CSB-YP019897HU
• Hersteller Artikelnummer: CSB-YP019897HU
• Alternativnummer: CSB-YP019897HU-1, CSB-YP019897HU-100, CSB-YP019897HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: CKII beta-binding protein 1 ,CKBBP1RING finger protein 7Regulator of cullins 2Sensitive to apoptosis gene protein

Produkteigenschaften

• Molekulargewicht: 14.6 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: Q9UBF6
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 2-113aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: ADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK