Recombinant Human Ropporin-1B (ROPN1B)

Produktübersicht

• Artikelname: Recombinant Human Ropporin-1B (ROPN1B)
• Artikelnummer: CSB-YP020065HU
• Hersteller Artikelnummer: CSB-YP020065HU
• Alternativnummer: CSB-YP020065HU-1, CSB-YP020065HU-100, CSB-YP020065HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Rhophilin-associated protein 1B

Produkteigenschaften

• Molekulargewicht: 15.6 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: Q9BZX4
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 1-120aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE