Recombinant Rat Protein S100-A8 (S100a8)
Artikelnummer:
CSB-YP020641RA
- Bilder (0)
| Artikelname: | Recombinant Rat Protein S100-A8 (S100a8) |
| Artikelnummer: | CSB-YP020641RA |
| Hersteller Artikelnummer: | CSB-YP020641RA |
| Alternativnummer: | CSB-YP020641RA-1, CSB-YP020641RA-100, CSB-YP020641RA-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Calgranulin-AMigration inhibitory factor-related protein 8 ,MRP-8 ,p8S100 calcium-binding protein A8 |
| Molekulargewicht: | 12.1 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P50115 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Yeast |
| Expression System: | 2-89aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | ATELEKALSNVIEVYHNYSGIKGNHHALYRDDFRKMVTTECPQFVQNKNTESLFKELDVNSDNAINFEEFLVLVIRVGVAAHKDSHKE |
Produktgarantie und fachkundiger Support
