Recombinant Pig Pulmonary surfactant-associated protein B (SFTPB)

Produktübersicht

• Artikelname: Recombinant Pig Pulmonary surfactant-associated protein B (SFTPB)
• Artikelnummer: CSB-YP021173PI
• Hersteller Artikelnummer: CSB-YP021173PI
• Alternativnummer: CSB-YP021173PI-1, CSB-YP021173PI-100, CSB-YP021173PI-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Pulmonary surfactant-associated protein B(SP-B)(8 kDa protein)(Pulmonary surfactant-associated proteolipid SPL(Phe))

Produkteigenschaften

• Molekulargewicht: 8.7 kDa
• Tag: Tag-Free
• UniProt: P15782
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 1-79aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: FPIPLPFCWLCRTLIKRIQAVVPKGVLLKAVAQVCHVVPLPVGGICQCLAERYIVICLNMLLDRTLPQLVCGLVLRCSS