Recombinant Human Very long-chain acyl-CoA synthetase (SLC27A2), partial

Produktübersicht

• Artikelname: Recombinant Human Very long-chain acyl-CoA synthetase (SLC27A2), partial
• Artikelnummer: CSB-YP021534HU
• Hersteller Artikelnummer: CSB-YP021534HU
• Alternativnummer: CSB-YP021534HU-1, CSB-YP021534HU-100, CSB-YP021534HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Fatty acid transport protein 2 ,FATP-2Fatty-acid-coenzyme A ligase, very long-chain 1Long-chain-fatty-acid--CoA ligase (EC:6.2.1.3)Solute carrier family 27 member 2THCA-CoA ligaseVery long-chain-fatty-acid-CoA ligase

Produkteigenschaften

• Molekulargewicht: 40.8 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: O14975
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 283-620aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: GATLALRTKFSASQFWDDCRKYNVTVIQYIGELLRYLCNSPQKPNDRDHKVRLALGNGLRGDVWRQFVKRFGDICIYEFYAATEGNIGFMNYARKVGAVGRVNYLQKKIITYDLIKYDVEKDEPVRDENGYCVRVPKGEVGLLVCKITQLTPFNGYAGAKAQTEKKKLRDVFKKGDLYFNSGDLLMVDHENFIYFHDRVGDTFRWKGENVATTEVADTVGLVDFVQEVNVYGVHVPDHEGRIGMASIKMKENHE