Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2), partial

Produktübersicht

• Artikelname: Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2), partial
• Artikelnummer: CSB-YP021581HU
• Hersteller Artikelnummer: CSB-YP021581HU
• Alternativnummer: CSB-YP021581HU-1, CSB-YP021581HU-100, CSB-YP021581HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Na(+)-dependent phosphate cotransporter 2BNaPi3bSodium/phosphate cotransporter 2B ,Na(+)/Pi cotransporter 2B ,NaPi-2bSolute carrier family 34 member 2

Produkteigenschaften

• Molekulargewicht: 15.1 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: O95436
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 574-689aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: LLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTA