Recombinant Human Small proline-rich protein 2B (SPRR2B)
Artikelnummer:
CSB-YP022613HUB1
- Bilder (0)
| Artikelname: | Recombinant Human Small proline-rich protein 2B (SPRR2B) |
| Artikelnummer: | CSB-YP022613HUB1 |
| Hersteller Artikelnummer: | CSB-YP022613HUb1 |
| Alternativnummer: | CSB-YP022613HUB1-1, CSB-YP022613HUB1-100, CSB-YP022613HUB1-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | SPRR2B, Small proline-rich protein 2B, SPR-2B |
| Molekulargewicht: | 12 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | P35325 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Yeast |
| Expression System: | 1-72aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQPKYPPKSK |
Produktgarantie und fachkundiger Support
