Recombinant Pig Transcobalamin-1 (TCN1)

Produktübersicht

• Artikelname: Recombinant Pig Transcobalamin-1 (TCN1)
• Artikelnummer: CSB-YP023317PI
• Hersteller Artikelnummer: CSB-YP023317PI
• Alternativnummer: CSB-YP023317PI-1, CSB-YP023317PI-100, CSB-YP023317PI-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: CobalophilinHaptocorrin,Protein RTranscobalamin I ,TC I ,TCI

Produkteigenschaften

• Molekulargewicht: 46.3 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: P17630
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 25-416aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: CVVSEKDYSHLRLLISAMDNLEQIRGIYGASILLSQRLAGIQNPSLEEELSQRIQDDMNRRDMSNLTSGQLALIILAFGACKTPDVRFIHDHHLVEKLGEKFKEEIKNMEIHNSNPLTNYYQLSFDVLTLCLFRGNYSISNVTHYFNPENKNFNLSGHFSVDTGAVAVLALTCVKRSISNGKIKAAIKDSDTIQKYIESLVHKIQSEKMVVSLETRIAQEKLCRLSLSHQTITKMNQIAKKLWTRCLTHSQGVF