Recombinant Mouse Thrombospondin-2 (Thbs2), partial

Artikelnummer: CSB-YP023488MO
Artikelname: Recombinant Mouse Thrombospondin-2 (Thbs2), partial
Artikelnummer: CSB-YP023488MO
Hersteller Artikelnummer: CSB-YP023488MO
Alternativnummer: CSB-YP023488MO-1, CSB-YP023488MO-100, CSB-YP023488MO-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Thbs2, Tsp2, Thrombospondin-2
Molekulargewicht: 26.1 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q03350
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Expression System: 19-232aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GDHVKDTSFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRFDYIPPVNTDDLNRIVKLARRKEGFFLTAQLKQDRKSRGTLLVLEGPGTSQRQFEIVSNGPGDTLDLNYWVEGNQHTNFLEDVGLADSQWKNVTVQVASDTYSLYVGCDLIDSVTLEEPFYEQLEVDRSRMYVAKGASRESHFRGLLQNVHLVFADSVEDILSKKGCQHSQGA