Recombinant Human Cell surface hyaluronidase (TMEM2), partial
Artikelnummer:
CSB-YP023791HU
- Bilder (0)
| Artikelname: | Recombinant Human Cell surface hyaluronidase (TMEM2), partial |
| Artikelnummer: | CSB-YP023791HU |
| Hersteller Artikelnummer: | CSB-YP023791HU |
| Alternativnummer: | CSB-YP023791HU-1, CSB-YP023791HU-100, CSB-YP023791HU-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Cell migration-inducing hyaluronidase 2 (Transmembrane protein 2) (KIAA1412) (TMEM2) |
| Molekulargewicht: | 18.0 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q9UHN6 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Yeast |
| Expression System: | 104-250aa |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | SSKYAPDENCPDQNPRLRNWDPGQDSAKQVVIKEGDMLRLTSDATVHSIVIQDGGLLVFGDNKDGSRNITLRTHYILIQDGGALHIGAEKCRYKSKATITLYGKSDEGESMPTFGKKFIGVEAGGTLELHGARKASWTLLARTLNSS |
Produktgarantie und fachkundiger Support
