Recombinant Human Cellular tumor antigen p53 (TP53)

Produktübersicht

• Artikelname: Recombinant Human Cellular tumor antigen p53 (TP53)
• Artikelnummer: CSB-YP024077HU
• Hersteller Artikelnummer: CSB-YP024077HU
• Alternativnummer: CSB-YP024077HU-1, CSB-YP024077HU-100, CSB-YP024077HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Antigen NY-CO-13 Phosphoprotein p53 Tumor suppressor p53

Produkteigenschaften

• Molekulargewicht: 45.7 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: P04637
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 1-393aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTI