Recombinant Xenopus laevis Transthyretin (ttr)

Produktübersicht

• Artikelname: Recombinant Xenopus laevis Transthyretin (ttr)
• Artikelnummer: CSB-YP025270XBE
• Hersteller Artikelnummer: CSB-YP025270XBE
• Alternativnummer: CSB-YP025270XBE-1, CSB-YP025270XBE-100, CSB-YP025270XBE-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Transthyretin(xTTR)(Prealbumin),CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 16.7 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: B7ZS96
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 20-153aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: APPGHASHGEADSKCPLMVKVLDAVRGIPAANLLVNVFRQTESGKWEQITSGKTTELGEIHNLTTDEQFTEGVYKIEFATKAFWGKLGLSPFHEYVDVVFTANDAGHRHYTIAVLLTPYSFSSTAIVSEPHDDL