Recombinant Mouse Ubiquitin-protein ligase E3A (Ube3a), partial

Produktübersicht

• Artikelname: Recombinant Mouse Ubiquitin-protein ligase E3A (Ube3a), partial
• Artikelnummer: CSB-YP025488MO
• Hersteller Artikelnummer: CSB-YP025488MO
• Alternativnummer: CSB-YP025488MO-1, CSB-YP025488MO-100, CSB-YP025488MO-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Oncogenic protein-associated protein E6-AP,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 39.9 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: O08759
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 542-870aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: NPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDEATKLFWFNPSSFETEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDLLEYEGSVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEYDGGYTRESVVIREFWEIVHSFTDE