Recombinant Mouse Uromodulin (Umod), partial

Artikelnummer: CSB-YP025616MO
Artikelname: Recombinant Mouse Uromodulin (Umod), partial
Artikelnummer: CSB-YP025616MO
Hersteller Artikelnummer: CSB-YP025616MO
Alternativnummer: CSB-YP025616MO-1, CSB-YP025616MO-100, CSB-YP025616MO-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Tamm-Horsfall urinary glycoprotein Short name: THP Cleaved into the following chain: Uromodulin, secreted form
Molekulargewicht: 64.2 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q91X17
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Expression System: 25-588aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: NSTEARRCSECHNNATCTVDGVVTTCSCQTGFTGDGLVCEDMDECATPWTHNCSNSSCVNTPGSFKCSCQDGFRLTPELSCTDVDECSEQGLSNCHALATCVNTEGDYLCVCPEGFTGDGWYCECSPGSCEPGLDCLPQGPDGKLVCQDPCNTYETLTEYWRSTEYGVGYSCDAGLHGWYRFTGQGGVRMAETCVPVLRCNTAAPMWLNGSHPSSSEGIVSRTACAHWSDQCCRWSTEIQVKACPGGFYIYNLT