Recombinant Rabbit Vascular endothelial growth factor A (VEGFA)

Produktübersicht

• Artikelname: Recombinant Rabbit Vascular endothelial growth factor A (VEGFA)
• Artikelnummer: CSB-YP025833RB
• Hersteller Artikelnummer: CSB-YP025833RB
• Alternativnummer: CSB-YP025833RB-1, CSB-YP025833RB-100, CSB-YP025833RB-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: /

Produkteigenschaften

• Molekulargewicht: 51.7 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: XP_002714743.1
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 51-511aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: YLWLLHAPLLHVSLDSLVAAFSVVFEVLPSSLDIPGSKKEEQASTQLGGVEEEHEASGVVTRQLAFVVDAITNPTLEKETKTITRIHKAPKFPSHFGFWKRAEEERGGKSSGEKSRKTDGVGERAQAGEQREGPGQRAAALTDRQTDTAPSPSAHLLPGRRPTVDAAASGGQQPEPAPEGGVEGVGARGIALKLFVQLLGCSRSGGVVVRAGGAEPSGAARSVSSGREEPPPPPPEEEGEEEGEKEEERGPRWR