Recombinant Human Transcription cofactor vestigial-like protein 3 (VGLL3)

Produktübersicht

• Artikelname: Recombinant Human Transcription cofactor vestigial-like protein 3 (VGLL3)
• Artikelnummer: CSB-YP025850HU
• Hersteller Artikelnummer: CSB-YP025850HU
• Alternativnummer: CSB-YP025850HU-1, CSB-YP025850HU-100, CSB-YP025850HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: VGLL3, Transcription cofactor vestigial-like protein 3, Vgl-3

Produkteigenschaften

• Molekulargewicht: 37.2 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: A8MV65
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 1-320aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MSCAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQEEEDEEEEEEEKDQPAEMEYLNSRCVLFTYFQGDIGSVVDEHFSRALGQAITLHPESAISKSKMGLTPLWRDSSALSSQRNSFPTSFWTSSYQPPPAPCLGGVHPDFQVTGPPGTFSAADPSPWPGHNLHQTGPAPPPAVSESWPYPLTSQVSPSYSHMHDVYMRHHHPHAHMHHRHRHHHHHHHPPAGSA