Recombinant Mouse Y-box-binding protein 1 (Ybx1)

Produktübersicht

• Artikelname: Recombinant Mouse Y-box-binding protein 1 (Ybx1)
• Artikelnummer: CSB-YP026247MO
• Hersteller Artikelnummer: CSB-YP026247MO
• Alternativnummer: CSB-YP026247MO-1, CSB-YP026247MO-100, CSB-YP026247MO-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: CCAAT-binding transcription factor I subunit A ,CBF-ADNA-binding protein B ,DBPBEnhancer factor I subunit A ,EFI-AY-box transcription factorY-box-binding protein 1 ,YB-1

Produkteigenschaften

• Molekulargewicht: 37.6 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: P62960
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 2-322aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: SSEAETQQPPAAPAAALSAADTKPGSTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYARRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPRE