Recombinant Human YjeF N-terminal domain-containing protein 3 (YJEFN3)

Produktübersicht

• Artikelname: Recombinant Human YjeF N-terminal domain-containing protein 3 (YJEFN3)
• Artikelnummer: CSB-YP026264HU
• Hersteller Artikelnummer: CSB-YP026264HU
• Alternativnummer: CSB-YP026264HU-1, CSB-YP026264HU-100, CSB-YP026264HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: YjeF_N3 (hYjeF_N3),CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 33.2 kDa
• Tag: Tag-Free
• UniProt: A6XGL0
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 1-299aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MSSAAGPDPSEAPEERHFLRALELQPPLADMGRAELSSNATTSLVQRRKQAWGRQSWLEQIWNAGPVCQSTAEAAALERELLEDYRFGRQQLVELCGHASAVAVTKAFPLPALSRKQRTVLVVCGPEQNGAVGLVCARHLRVFEYEPTIFYPTRSLDLLHRDLTTQCEKMDIPFLSYLPTEVQLINEAYGLVVDAVLGPGVEPGEVGGPCTRALATLKLLSIPLVSLDIPSGWDAETGSDSEDGLRPDVLVSLA